Lineage for d2xbta_ (2xbt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767350Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 2767351Protein automated matches [191113] (13 species)
    not a true protein
  7. 2767364Species Bacteroides cellulosolvens [TaxId:35825] [189900] (2 PDB entries)
  8. 2767365Domain d2xbta_: 2xbt A: [170004]
    automated match to d1nbca_
    complexed with no3

Details for d2xbta_

PDB Entry: 2xbt (more details), 1.83 Å

PDB Description: Structure of a scaffoldin carbohydrate-binding module family 3b from the cellulosome of Bacteroides cellulosolvens: Structural diversity and implications for carbohydrate binding
PDB Compounds: (A:) cellulosomal scaffoldin

SCOPe Domain Sequences for d2xbta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xbta_ b.2.2.0 (A:) automated matches {Bacteroides cellulosolvens [TaxId: 35825]}
pvqvnsdlkllfsnngaaassnqiymnmklqntgsstydlskitiryfytsdddkaltyy
sdyvsigsasatfnnlspvhakankyieiklasgtlgaagaqwpsqsevtiqgrvakadw
tnvdqsndysypgsmsqfgenklvavyyngalvygtpp

SCOPe Domain Coordinates for d2xbta_:

Click to download the PDB-style file with coordinates for d2xbta_.
(The format of our PDB-style files is described here.)

Timeline for d2xbta_: