![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
![]() | Protein automated matches [191113] (13 species) not a true protein |
![]() | Species Bacteroides cellulosolvens [TaxId:35825] [189900] (2 PDB entries) |
![]() | Domain d2xbta_: 2xbt A: [170004] automated match to d1nbca_ complexed with no3 |
PDB Entry: 2xbt (more details), 1.83 Å
SCOPe Domain Sequences for d2xbta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xbta_ b.2.2.0 (A:) automated matches {Bacteroides cellulosolvens [TaxId: 35825]} pvqvnsdlkllfsnngaaassnqiymnmklqntgsstydlskitiryfytsdddkaltyy sdyvsigsasatfnnlspvhakankyieiklasgtlgaagaqwpsqsevtiqgrvakadw tnvdqsndysypgsmsqfgenklvavyyngalvygtpp
Timeline for d2xbta_: