SCOPe 2.03: Domain d2xbqb_: 2xbq B:

Lineage for d2xbqb_ (2xbq B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189028] (6 PDB entries)

8. Domain d2xbqb_: 2xbq B: [170003]
   automated match to d1xw9a_
   complexed with zn

Details for d2xbqb_

PDB Entry: 2xbq, 1.67 Å

PDB Description: Crystal structure of reduced Schistosoma mansoni Thioredoxin pre- protein at 1.7 Angstrom

PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d2xbqb_:

Sequence; same for both SEQRES and ATOM records:

>d2xbqb_ c.47.1.0 (B:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
selielkqdgdleslleqhknklvvvdffatwcgpcktiaplfkelsekydaifvkvdvd
kleetarkynisamptfiaikngekvgdvvgasiakvedmikkfi

Timeline for d2xbqb_:

• d2xbqb_ first appeared in SCOPe 2.01
  
• d2xbqb_ appears in SCOPe 2.02
  
• d2xbqb_ appears in SCOPe 2.04
  
• d2xbqb_ appears in the current release, SCOPe 2.08