SCOPe 2.06: Domain d2xbpa1: 2xbp A:1-112

Lineage for d2xbpa1 (2xbp A:1-112)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein automated matches [190670] (6 species)
   not a true protein

7. Species Synechococcus elongatus PCC 7942 [TaxId:1140] [189437] (4 PDB entries)

8. Domain d2xbpa1: 2xbp A:1-112 [170001]
   Other proteins in same PDB: d2xbpa2
   automated match to d1qy7a_
   complexed with atp, cl, mg

Details for d2xbpa1

PDB Entry: 2xbp, 1.2 Å

PDB Description: a novel signal transduction protein pii variant from synechococcus elongatus pcc7942 indicates a two-step process for nagk pii complex formation

PDB Compounds: (A:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d2xbpa1:

Sequence; same for both SEQRES and ATOM records:

>d2xbpa1 d.58.5.1 (A:1-112) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgengdgkifvspvdqtirirtgeknadai

Timeline for d2xbpa1:

• d2xbpa1 first appeared in SCOPe 2.01, called d2xbpa_
  
• d2xbpa1 was called d2xbpa_ in SCOPe 2.05
  
• d2xbpa1 appears in SCOPe 2.07
  
• d2xbpa1 appears in the current release, SCOPe 2.08