SCOPe 2.06: Domain d2xbia1: 2xbi A:1-106

Lineage for d2xbia1 (2xbi A:1-106)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189028] (9 PDB entries)

8. Domain d2xbia1: 2xbi A:1-106 [169992]
   Other proteins in same PDB: d2xbia2
   automated match to d1xwaa_
   complexed with gol

Details for d2xbia1

PDB Entry: 2xbi, 1.6 Å

PDB Description: Crystal structure of Schistosoma mansoni Thioredoxin at 1.6 Angstrom

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2xbia1:

Sequence; same for both SEQRES and ATOM records:

>d2xbia1 c.47.1.0 (A:1-106) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
msklielkqdgdleslleqhknklvvvdffatwcgpcktiaplfkelsekydaifvkvdv
dkleetarkynisamptfiaikngekvgdvvgasiakvedmikkfi

Timeline for d2xbia1:

• d2xbia1 first appeared in SCOPe 2.01, called d2xbia_
  
• d2xbia1 was called d2xbia_ in SCOPe 2.05
  
• d2xbia1 appears in SCOPe 2.07
  
• d2xbia1 appears in the current release, SCOPe 2.08