Lineage for d1ecia_ (1eci A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995632Fold a.33: Ectatomin subunits [47400] (1 superfamily)
    4 helices; bundle, closed, left-handed twist
  4. 1995633Superfamily a.33.1: Ectatomin subunits [47401] (1 family) (S)
    disulfide-linked heterodimer of similar alpha-hairpin subunits
  5. 1995634Family a.33.1.1: Ectatomin subunits [47402] (2 proteins)
  6. 1995635Protein Ectatomin subunit A, EA [88837] (1 species)
  7. 1995636Species Ant (Ectatomma tuberculatum), venom [TaxId:39300] [88838] (1 PDB entry)
  8. 1995637Domain d1ecia_: 1eci A: [16999]
    Other proteins in same PDB: d1ecib_

Details for d1ecia_

PDB Entry: 1eci (more details)

PDB Description: ectatomin (water solution, nmr 20 structures)
PDB Compounds: (A:) ectatomin

SCOPe Domain Sequences for d1ecia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecia_ a.33.1.1 (A:) Ectatomin subunit A, EA {Ant (Ectatomma tuberculatum), venom [TaxId: 39300]}
gvipkkiwetvcptvepwakkcsgdiatyikrecgkl

SCOPe Domain Coordinates for d1ecia_:

Click to download the PDB-style file with coordinates for d1ecia_.
(The format of our PDB-style files is described here.)

Timeline for d1ecia_:

1995637
d1ecia_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1ecib_