Lineage for d2xb6c_ (2xb6 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779532Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2779614Protein automated matches [190380] (3 species)
    not a true protein
  7. 2779644Species Norway rat (Rattus norvegicus) [TaxId:10116] [189379] (3 PDB entries)
  8. 2779646Domain d2xb6c_: 2xb6 C: [169984]
    Other proteins in same PDB: d2xb6a1, d2xb6a2, d2xb6b1, d2xb6b2
    automated match to d1c4rg_
    complexed with ca, cl, edo, mes, nag

Details for d2xb6c_

PDB Entry: 2xb6 (more details), 2.6 Å

PDB Description: revisited crystal structure of neurexin1beta-neuroligin4 complex
PDB Compounds: (C:) Neurexin-1-beta

SCOPe Domain Sequences for d2xb6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xb6c_ b.29.1.4 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlv

SCOPe Domain Coordinates for d2xb6c_:

Click to download the PDB-style file with coordinates for d2xb6c_.
(The format of our PDB-style files is described here.)

Timeline for d2xb6c_: