SCOPe 2.02: Domain d2xaic_: 2xai C:

Lineage for d2xaic_ (2xai C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (37 PDB entries)

8. Domain d2xaic_: 2xai C: [169981]
   Other proteins in same PDB: d2xaib_, d2xaie_
   automated match to d1lm8b_
   complexed with cl, edo, peg

Details for d2xaic_

PDB Entry: 2xai, 2.58 Å

PDB Description: Crystal structure of ankyrin repeat and SOCS box-containing protein 9 (ASB9) in complex with elonginB and elonginC

PDB Compounds: (C:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d2xaic_:

Sequence, based on SEQRES records:

>d2xaic_ d.15.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg
ftsqtarpqapatvglafraddtfealciepfssppelpdvmkp

Sequence, based on observed residues (ATOM records):

>d2xaic_ d.15.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvflmirrhkttiftdakstvfelkrivegilkrppkddqlftsqtarpqapatvepfss
ppelpdvmkp

Timeline for d2xaic_:

• d2xaic_ first appeared in SCOPe 2.01
  
• d2xaic_ does not appear in SCOPe 2.03