SCOP 1.75: Domain d1ytfd1: 1ytf D:5-54

Lineage for d1ytfd1 (1ytf D:5-54)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.32: Transcription factor IIA (TFIIA), alpha-helical domain [47395] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.32.1: Transcription factor IIA (TFIIA), alpha-helical domain [47396] (1 family)
   dimer of non-identical alpha-hairpins

5. Family a.32.1.1: Transcription factor IIA (TFIIA), alpha-helical domain [47397] (2 proteins)
   heterodimer of two homologous chains

6. Protein Small chain TOA2, N-terminal domain [88835] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88836] (3 PDB entries)

8. Domain d1ytfd1: 1ytf D:5-54 [16998]
   Other proteins in same PDB: d1ytfa1, d1ytfa2, d1ytfb_, d1ytfc_, d1ytfd2
   protein/DNA complex

Details for d1ytfd1

PDB Entry: 1ytf, 2.5 Å

PDB Description: yeast tfiia/tbp/dna complex

PDB Compounds: (D:) protein (transcription factor iia - toa2 subunit)

SCOP Domain Sequences for d1ytfd1:

Sequence; same for both SEQRES and ATOM records:

>d1ytfd1 a.32.1.1 (D:5-54) Small chain TOA2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gyyelyrrstignslvdaldtlisdgrieaslamrvletfdkvvaetlkd

Timeline for d1ytfd1:

• d1ytfd1 first appeared (with stable ids) in SCOP 1.55
  
• d1ytfd1 appears in SCOP 1.73
  
• d1ytfd1 appears in SCOPe 2.01
  
• d1ytfd1 appears in the current release, SCOPe 2.08