Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein automated matches [190803] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries) |
Domain d2xacx_: 2xac X: [169976] Other proteins in same PDB: d2xaca_, d2xacb_ automated match to d1qsva_ complexed with gol |
PDB Entry: 2xac (more details), 2.71 Å
SCOPe Domain Sequences for d2xacx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xacx_ b.1.1.4 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]} grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg fiisnatykeiglltceatvnghlyktnylthrqt
Timeline for d2xacx_: