Lineage for d2xacc_ (2xac C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753968Protein automated matches [190803] (3 species)
    not a true protein
  7. 2753969Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)
  8. 2754025Domain d2xacc_: 2xac C: [169975]
    Other proteins in same PDB: d2xaca_, d2xacb_
    automated match to d1qsva_
    complexed with gol

Details for d2xacc_

PDB Entry: 2xac (more details), 2.71 Å

PDB Description: structural insights into the binding of vegf-b by vegfr-1d2: recognition and specificity
PDB Compounds: (C:) vascular endothelial growth factor receptor 1

SCOPe Domain Sequences for d2xacc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xacc_ b.1.1.4 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdtgrpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwds
rkgfiisnatykeiglltceatvnghlyktnylthrqt

SCOPe Domain Coordinates for d2xacc_:

Click to download the PDB-style file with coordinates for d2xacc_.
(The format of our PDB-style files is described here.)

Timeline for d2xacc_: