Lineage for d2xacb_ (2xac B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260706Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 2260707Protein automated matches [190506] (3 species)
    not a true protein
  7. 2260708Species Human (Homo sapiens) [TaxId:9606] [187459] (23 PDB entries)
  8. 2260744Domain d2xacb_: 2xac B: [169974]
    Other proteins in same PDB: d2xacc_, d2xacx_
    automated match to d1katv_
    complexed with gol

Details for d2xacb_

PDB Entry: 2xac (more details), 2.71 Å

PDB Description: structural insights into the binding of vegf-b by vegfr-1d2: recognition and specificity
PDB Compounds: (B:) vascular endothelial growth factor b

SCOPe Domain Sequences for d2xacb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xacb_ g.17.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrkvvswidvytratcqprevvvpltvelmgtvakqlvpscvtvqrcggccpddglecvp
tgqhqvrmqilmirypssqlgemsleehsqcecrpkkk

SCOPe Domain Coordinates for d2xacb_:

Click to download the PDB-style file with coordinates for d2xacb_.
(The format of our PDB-style files is described here.)

Timeline for d2xacb_: