Lineage for d1ytfb_ (1ytf B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995616Fold a.32: Transcription factor IIA (TFIIA), alpha-helical domain [47395] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 1995617Superfamily a.32.1: Transcription factor IIA (TFIIA), alpha-helical domain [47396] (1 family) (S)
    dimer of non-identical alpha-hairpins
  5. 1995618Family a.32.1.1: Transcription factor IIA (TFIIA), alpha-helical domain [47397] (2 proteins)
    heterodimer of two homologous chains
  6. 1995619Protein Large chain TOA1, N-terminal domain [88833] (2 species)
  7. 1995620Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88834] (2 PDB entries)
  8. 1995622Domain d1ytfb_: 1ytf B: [16997]
    Other proteins in same PDB: d1ytfa1, d1ytfa2, d1ytfc_, d1ytfd1, d1ytfd2
    protein/DNA complex

Details for d1ytfb_

PDB Entry: 1ytf (more details), 2.5 Å

PDB Description: yeast tfiia/tbp/dna complex
PDB Compounds: (B:) protein (transcription factor iia - toa1n subunit)

SCOPe Domain Sequences for d1ytfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytfb_ a.32.1.1 (B:) Large chain TOA1, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
snaeasrvyeiivesvvnevredfenagideqtlqdlkniwqkklt

SCOPe Domain Coordinates for d1ytfb_:

Click to download the PDB-style file with coordinates for d1ytfb_.
(The format of our PDB-style files is described here.)

Timeline for d1ytfb_: