SCOPe 2.08: Domain d2x9bb_: 2x9b B:

Lineage for d2x9bb_ (2x9b B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.37: N-terminal domains of the minor coat protein g3p [50175] (1 superfamily)
   core: barrel, in some members open; n*=4, S*=8; meander

4. Superfamily b.37.1: N-terminal domains of the minor coat protein g3p [50176] (2 families)

5. Family b.37.1.0: automated matches [191652] (1 protein)
   not a true family

6. Protein automated matches [191207] (4 species)
   not a true protein

7. Species Enterobacteria phage [TaxId:10868] [189551] (2 PDB entries)

8. Domain d2x9bb_: 2x9b B: [169967]
   automated match to d1fgpa_

Details for d2x9bb_

PDB Entry: 2x9b, 2.92 Å

PDB Description: the filamentous phages fd and if1 use different infection mechanisms

PDB Compounds: (B:) attachment protein g3p

SCOPe Domain Sequences for d2x9bb_:

Sequence; same for both SEQRES and ATOM records:

>d2x9bb_ b.37.1.0 (B:) automated matches {Enterobacteria phage [TaxId: 10868]}
attdaeclskpafdgtlsnvwkegdsryanfenciyelsgigigydndtswnghwtpvra
a

Timeline for d2x9bb_:

• d2x9bb_ first appeared in SCOPe 2.01
  
• d2x9bb_ appears in SCOPe 2.07