Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2x9bb_ (2x9b B:)

  1. Root: SCOP 1.75B
  2. Class b: All beta proteins [48724] (174 folds)
  3. Fold b.37: N-terminal domains of the minor coat protein g3p [50175] (1 superfamily)
    core: barrel, in some members open; n*=4, S*=8; meander
  4. Superfamily b.37.1: N-terminal domains of the minor coat protein g3p [50176] (2 families) (S)
  5. Family b.37.1.0: automated matches [191652] (1 protein)
    not a true family
  6. Protein automated matches [191207] (1 species)
    not a true protein
  7. Species Enterobacteria phage [TaxId:10868] [189551] (2 PDB entries)
  8. Domain d2x9bb_: 2x9b B: [169967]
    automated match to d1fgpa_

Details for d2x9bb_

PDB Entry: 2x9b (more details)
PDB Description: the filamentous phages fd and if1 use different infection mechanisms
PDB Compounds: (B:) attachment protein g3p

SCOP Domain Sequences for d2x9bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x9bb_ b.37.1.0 (B:) automated matches {Enterobacteria phage [TaxId: 10868]}
attdaeclskpafdgtlsnvwkegdsryanfenciyelsgigigydndtswnghwtpvra
a

SCOP Domain Coordinates for d2x9bb_:

Click to download the PDB-style file with coordinates for d2x9bb_.
(The format of our PDB-style files is described here.)

Timeline for d2x9bb_:

d2x9bb_ appears in SCOP 1.75A


d2x9bb_
(click for larger image)


d2x9bb_ in context of PDB
Domains from other chains:
d2x9ba_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu