Class b: All beta proteins [48724] (174 folds) |
Fold b.37: N-terminal domains of the minor coat protein g3p [50175] (1 superfamily) core: barrel, in some members open; n*=4, S*=8; meander |
Superfamily b.37.1: N-terminal domains of the minor coat protein g3p [50176] (2 families) |
Family b.37.1.0: automated matches [191652] (1 protein) not a true family |
Protein automated matches [191207] (1 species) not a true protein |
Species Enterobacteria phage [TaxId:10868] [189551] (2 PDB entries) |
Domain d2x9aa_: 2x9a A: [169964] automated match to d1fgpa_ |
PDB Entry: 2x9a (more details), 2.47 Å
SCOPe Domain Sequences for d2x9aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x9aa_ b.37.1.0 (A:) automated matches {Enterobacteria phage [TaxId: 10868]} ttdaeclskpafdgtlsnvwkegdsryanfenciyelsgigigydndtswnghwtpvraa d
Timeline for d2x9aa_: