Lineage for d2x9aa_ (2x9a A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786733Fold b.37: N-terminal domains of the minor coat protein g3p [50175] (1 superfamily)
    core: barrel, in some members open; n*=4, S*=8; meander
  4. 2786734Superfamily b.37.1: N-terminal domains of the minor coat protein g3p [50176] (2 families) (S)
  5. 2786754Family b.37.1.0: automated matches [191652] (1 protein)
    not a true family
  6. 2786755Protein automated matches [191207] (4 species)
    not a true protein
  7. 2786765Species Enterobacteria phage [TaxId:10868] [189551] (2 PDB entries)
  8. 2786768Domain d2x9aa_: 2x9a A: [169964]
    Other proteins in same PDB: d2x9ab1, d2x9ab2, d2x9ad1, d2x9ad2
    automated match to d1fgpa_

Details for d2x9aa_

PDB Entry: 2x9a (more details), 2.47 Å

PDB Description: crystal structure of g3p from phage if1 in complex with its coreceptor, the c-terminal domain of tola
PDB Compounds: (A:) attachment protein g3p

SCOPe Domain Sequences for d2x9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x9aa_ b.37.1.0 (A:) automated matches {Enterobacteria phage [TaxId: 10868]}
ttdaeclskpafdgtlsnvwkegdsryanfenciyelsgigigydndtswnghwtpvraa
d

SCOPe Domain Coordinates for d2x9aa_:

Click to download the PDB-style file with coordinates for d2x9aa_.
(The format of our PDB-style files is described here.)

Timeline for d2x9aa_: