![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.5: Neurolysin-like [55505] (5 proteins) combines M2, M3 and M32 families of metalloproteases the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain |
![]() | Protein automated matches [190340] (5 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189355] (16 PDB entries) |
![]() | Domain d2x95a_: 2x95 A: [169961] automated match to d1j36a_ complexed with epe, nag, x95, zn |
PDB Entry: 2x95 (more details), 1.96 Å
SCOPe Domain Sequences for d2x95a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x95a_ d.92.1.5 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} alvkeeiqakeylenlnkelakrtnveteaawaygsnitdenekkkneisaelakfmkev asdttkfqwrsyqsedlkrqfkaltklgyaalpeddyaelldtlsamesnfakvkvcdyk dstkcdlaldpeieevisksrdheelayywrefydkagtavrsqferyvelntkaaklnn ftsgaeawldeyeddtfeqqledifadirplyqqihgyvrfrlrkhygdavvsetgpipm hllgnmwaqqwseiadivspfpekplvdvsaemekqgytplkmfqmgddfftsmnltklp qdfwdksiiekptdgrdlvchasawdfyltddvrikqctrvtqdqlftvhhelghiqyfl qyqhqpfvyrtganpgfheavgdvlslsvstpkhlekigllkdyvrddearinqlfltal dkivflpfaftmdkyrwslfrgevdkanwncafwklrdeysgieppvvrsekdfdapaky hisadveylrylvsfiiqfqfyksacikagqydpdnvelpldncdiygsaaagaafhnml smgaskpwpdaleafngerimsgkaiaeyfeplrvwleaeniknnvhigwttsnkcvs
Timeline for d2x95a_: