SCOP 1.73: Domain d1r2ab_: 1r2a B:

Lineage for d1r2ab_ (1r2a B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (1 family)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (2 proteins)

6. Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47394] (6 PDB entries)

8. Domain d1r2ab_: 1r2a B: [16996]

Details for d1r2ab_

PDB Entry: 1r2a

PDB Description: the molecular basis for protein kinase a anchoring revealed by solution nmr

PDB Compounds: (B:) protein (camp-dependent protein kinase type II regulatory subunit)

SCOP Domain Sequences for d1r2ab_:

Sequence; same for both SEQRES and ATOM records:

>d1r2ab_ a.31.1.1 (B:) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]}
hmghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr

Timeline for d1r2ab_:

• d1r2ab_ first appeared (with stable ids) in SCOP 1.55
  
• d1r2ab_ appears in SCOP 1.71
  
• d1r2ab_ appears in SCOP 1.75
  
• d1r2ab_ appears in the current release, SCOPe 2.08, called d1r2ab1