SCOPe 2.08: Domain d1r2ab1: 1r2a B:2-46

Lineage for d1r2ab1 (1r2a B:2-46)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)

6. Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47394] (4 PDB entries)

8. Domain d1r2ab1: 1r2a B:2-46 [16996]
   Other proteins in same PDB: d1r2aa2, d1r2ab2

Details for d1r2ab1

PDB Entry: 1r2a

PDB Description: the molecular basis for protein kinase a anchoring revealed by solution nmr

PDB Compounds: (B:) protein (camp-dependent protein kinase type II regulatory subunit)

SCOPe Domain Sequences for d1r2ab1:

Sequence; same for both SEQRES and ATOM records:

>d1r2ab1 a.31.1.1 (B:2-46) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]}
mghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr

Timeline for d1r2ab1:

• d1r2ab1 first appeared (with stable ids) in SCOP 1.55, called d1r2ab_
  
• d1r2ab1 appears in SCOPe 2.07