Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.5: Neurolysin-like [55505] (5 proteins) combines M2, M3 and M32 families of metalloproteases the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain |
Protein automated matches [190340] (3 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189355] (13 PDB entries) |
Domain d2x8za_: 2x8z A: [169955] automated match to d1j36a_ complexed with nag, x8z, zn |
PDB Entry: 2x8z (more details), 1.98 Å
SCOPe Domain Sequences for d2x8za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x8za_ d.92.1.5 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} alvkeeiqakeylenlnkelakrtnveteaawaygsnitdenekkkneisaelakfmkev asdttkfqwrsyqsedlkrqfkaltklgyaalpeddyaelldtlsamesnfakvkvcdyk dstkcdlaldpeieevisksrdheelayywrefydkagtavrsqferyvelntkaaklnn ftsgaeawldeyeddtfeqqledifadirplyqqihgyvrfrlrkhygdavvsetgpipm hllgnmwaqqwseiadivspfpekplvdvsaemekqgytplkmfqmgddfftsmnltklp qdfwdksiiekptdgrdlvchasawdfyltddvrikqctrvtqdqlftvhhelghiqyfl qyqhqpfvyrtganpgfheavgdvlslsvstpkhlekigllkdyvrddearinqlfltal dkivflpfaftmdkyrwslfrgevdkanwncafwklrdeysgieppvvrsekdfdapaky hisadveylrylvsfiiqfqfyksacikagqydpdnvelpldncdiygsaaagaafhnml smgaskpwpdaleafngerimsgkaiaeyfeplrvwleaeniknnvhigwttsnkcvs
Timeline for d2x8za_: