Lineage for d2x8wa_ (2x8w A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467829Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2467830Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) (S)
    contains a common phosphate-binding site
  5. 2467874Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins)
  6. 2467914Protein automated matches [191238] (1 species)
    not a true protein
  7. 2467915Species Thermus sp. [TaxId:405418] [189683] (2 PDB entries)
  8. 2467919Domain d2x8wa_: 2x8w A: [169953]
    automated match to d1wo8b1
    complexed with mli

Details for d2x8wa_

PDB Entry: 2x8w (more details), 1.95 Å

PDB Description: the crystal structure of methylglyoxal synthase from thermus sp. gh5 bound to malonate.
PDB Compounds: (A:) methylglyoxal synthase

SCOPe Domain Sequences for d2x8wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x8wa_ c.24.1.2 (A:) automated matches {Thermus sp. [TaxId: 405418]}
mralaliahdakkeemvafcqrhrevlarfplvatgttgrrieeatgltvekllsgplgg
dqqmgarvaegrilaviffrdpltaqphepdvqallrvcdvhgvplatnpmaaealipwl
qslvg

SCOPe Domain Coordinates for d2x8wa_:

Click to download the PDB-style file with coordinates for d2x8wa_.
(The format of our PDB-style files is described here.)

Timeline for d2x8wa_: