Lineage for d1r2aa_ (1r2a A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640145Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 640146Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (1 family) (S)
    dimer of identical alpha-hairpin motifs
  5. 640147Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (2 proteins)
  6. 640152Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species)
  7. 640153Species Mouse (Mus musculus) [TaxId:10090] [47394] (6 PDB entries)
  8. 640172Domain d1r2aa_: 1r2a A: [16995]

Details for d1r2aa_

PDB Entry: 1r2a (more details)

PDB Description: the molecular basis for protein kinase a anchoring revealed by solution nmr
PDB Compounds: (A:) protein (camp-dependent protein kinase type II regulatory subunit)

SCOP Domain Sequences for d1r2aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2aa_ a.31.1.1 (A:) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]}
hmghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr

SCOP Domain Coordinates for d1r2aa_:

Click to download the PDB-style file with coordinates for d1r2aa_.
(The format of our PDB-style files is described here.)

Timeline for d1r2aa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r2ab_