SCOP 1.55: Domain d1r2aa_: 1r2a A:

Lineage for d1r2aa_ (1r2a A:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent type II PK regulatory subunit [47390] (1 superfamily)

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent type II PK regulatory subunit [47391] (1 family)

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent type II PK regulatory subunit [47392] (1 protein)

6. Protein Dimerization-anchoring domain of cAMP-dependent type II PK regulatory subunit [47393] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47394] (1 PDB entry)

8. Domain d1r2aa_: 1r2a A: [16995]

Details for d1r2aa_

PDB Entry: 1r2a

PDB Description: the molecular basis for protein kinase a anchoring revealed by solution nmr

SCOP Domain Sequences for d1r2aa_:

Sequence; same for both SEQRES and ATOM records:

>d1r2aa_ a.31.1.1 (A:) Dimerization-anchoring domain of cAMP-dependent type II PK regulatory subunit {Mouse (Mus musculus)}
hmghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr

Timeline for d1r2aa_:

• d1r2aa_ appears in SCOP 1.57
  
• d1r2aa_ appears in the current release, SCOPe 2.08, called d1r2aa1