Lineage for d2x8rb_ (2x8r B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095319Species Aspergillus fumigatus [TaxId:330879] [189460] (1 PDB entry)
  8. 2095321Domain d2x8rb_: 2x8r B: [169948]
    automated match to d1jfxa_
    complexed with cl

Details for d2x8rb_

PDB Entry: 2x8r (more details), 1.7 Å

PDB Description: The structure of a family GH25 lysozyme from Aspergillus fumigatus
PDB Compounds: (B:) glycosyl hydrolase

SCOPe Domain Sequences for d2x8rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x8rb_ c.1.8.0 (B:) automated matches {Aspergillus fumigatus [TaxId: 330879]}
attvqgfdisnhqksvnfeaakkdgaqfvmikategttykdtvfnshytgatkagllrgg
yhfarpdkstgstqakfflkngggwsddnrtlpgmldieynpygatcyglshsqmvawih
dfvneyhhatsrwpmiyttadwwnrctgnakgfgdkcplvlaaysssppktipgdwktwt
iwqnsdkykhggdsdkfngpmtqlrklasg

SCOPe Domain Coordinates for d2x8rb_:

Click to download the PDB-style file with coordinates for d2x8rb_.
(The format of our PDB-style files is described here.)

Timeline for d2x8rb_: