Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (90 species) not a true protein |
Species Aspergillus fumigatus [TaxId:330879] [189460] (1 PDB entry) |
Domain d2x8ra_: 2x8r A: [169947] automated match to d1jfxa_ complexed with cl |
PDB Entry: 2x8r (more details), 1.7 Å
SCOPe Domain Sequences for d2x8ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x8ra_ c.1.8.0 (A:) automated matches {Aspergillus fumigatus [TaxId: 330879]} ttvqgfdisnhqksvnfeaakkdgaqfvmikategttykdtvfnshytgatkagllrggy hfarpdkstgstqakfflkngggwsddnrtlpgmldieynpygatcyglshsqmvawihd fvneyhhatsrwpmiyttadwwnrctgnakgfgdkcplvlaaysssppktipgdwktwti wqnsdkykhggdsdkfngpmtqlrklasg
Timeline for d2x8ra_: