SCOPe 2.08: Domain d2x8da_: 2x8d A:

Lineage for d2x8da_ (2x8d A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d2x8da_: 2x8d A: [169944]
   automated match to d1ia8a_
   complexed with so4, x8d

Details for d2x8da_

PDB Entry: 2x8d, 1.9 Å

PDB Description: discovery of a novel class of triazolones as checkpoint kinase inhibitors - hit to lead exploration

PDB Compounds: (A:) Serine/threonine-protein kinase Chk1

SCOPe Domain Sequences for d2x8da_:

Sequence; same for both SEQRES and ATOM records:

>d2x8da_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
lhkilvenpsaritipdikkdrwynkplkkgakrprvtsg

Timeline for d2x8da_:

• d2x8da_ first appeared in SCOPe 2.01
  
• d2x8da_ appears in SCOPe 2.07