| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (4 PDB entries) |
| Domain d2x89g_: 2x89 G: [169942] Other proteins in same PDB: d2x89a_, d2x89b_, d2x89c_ automated match to d1a1mb_ |
PDB Entry: 2x89 (more details), 2.16 Å
SCOPe Domain Sequences for d2x89g_:
Sequence, based on SEQRES records: (download)
>d2x89g_ b.1.1.2 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdwsfyll
yyteftptekdeyacrvnhvtlsqpkivkwdr
>d2x89g_ b.1.1.2 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miqvysrhpgksnflncyvsgfhpsdievdllkngeriekvehsdlsfwsfyllyyteft
ptekdeyacrvnhvtlsqpkivkwdr
Timeline for d2x89g_: