Lineage for d2x89f_ (2x89 F:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294295Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
  8. 1294505Domain d2x89f_: 2x89 F: [169941]
    Other proteins in same PDB: d2x89a_, d2x89b_, d2x89c_
    automated match to d1a1mb_

Details for d2x89f_

PDB Entry: 2x89 (more details), 2.16 Å

PDB Description: Structure of the Beta2_microglobulin involved in amyloidogenesis
PDB Compounds: (F:) Beta-2-microglobulin

SCOPe Domain Sequences for d2x89f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x89f_ b.1.1.2 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdwsfyll
yyteftptekdeyacrvnhvtlsqpkivkwd

SCOPe Domain Coordinates for d2x89f_:

Click to download the PDB-style file with coordinates for d2x89f_.
(The format of our PDB-style files is described here.)

Timeline for d2x89f_: