Lineage for d2x89b_ (2x89 B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931683Protein automated matches [190119] (11 species)
    not a true protein
  7. 931708Species Human (Homo sapiens) [TaxId:9606] [188740] (24 PDB entries)
  8. 931754Domain d2x89b_: 2x89 B: [169937]
    Other proteins in same PDB: d2x89d_, d2x89e_, d2x89f_, d2x89g_
    automated match to d1jtoa_

Details for d2x89b_

PDB Entry: 2x89 (more details), 2.16 Å

PDB Description: Structure of the Beta2_microglobulin involved in amyloidogenesis
PDB Compounds: (B:) antibody

SCOPe Domain Sequences for d2x89b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x89b_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlqesgggsvqaggslrlscaasgytdsrycmawfrqapgkerewvarinsgrdityy
adsvkgrftfsqdnakntvylqmdslepedtatyycatdiplrcrdivakggdgfrywgq
gtqvtvss

SCOPe Domain Coordinates for d2x89b_:

Click to download the PDB-style file with coordinates for d2x89b_.
(The format of our PDB-style files is described here.)

Timeline for d2x89b_: