![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries) |
![]() | Domain d2x89b1: 2x89 B:6-128 [169937] Other proteins in same PDB: d2x89a2, d2x89b2, d2x89c2, d2x89d1, d2x89d2, d2x89e1, d2x89e2, d2x89f1, d2x89f2, d2x89g1, d2x89g2 automated match to d1jtoa_ |
PDB Entry: 2x89 (more details), 2.16 Å
SCOPe Domain Sequences for d2x89b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x89b1 b.1.1.1 (B:6-128) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} esgggsvqaggslrlscaasgytdsrycmawfrqapgkerewvarinsgrdityyadsvk grftfsqdnakntvylqmdslepedtatyycatdiplrcrdivakggdgfrywgqgtqvt vss
Timeline for d2x89b1: