Lineage for d2x89b1 (2x89 B:6-128)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742101Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)
  8. 2742131Domain d2x89b1: 2x89 B:6-128 [169937]
    Other proteins in same PDB: d2x89a2, d2x89b2, d2x89c2, d2x89d1, d2x89d2, d2x89e1, d2x89e2, d2x89f1, d2x89f2, d2x89g1, d2x89g2
    automated match to d1jtoa_

Details for d2x89b1

PDB Entry: 2x89 (more details), 2.16 Å

PDB Description: Structure of the Beta2_microglobulin involved in amyloidogenesis
PDB Compounds: (B:) antibody

SCOPe Domain Sequences for d2x89b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x89b1 b.1.1.1 (B:6-128) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
esgggsvqaggslrlscaasgytdsrycmawfrqapgkerewvarinsgrdityyadsvk
grftfsqdnakntvylqmdslepedtatyycatdiplrcrdivakggdgfrywgqgtqvt
vss

SCOPe Domain Coordinates for d2x89b1:

Click to download the PDB-style file with coordinates for d2x89b1.
(The format of our PDB-style files is described here.)

Timeline for d2x89b1: