![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
![]() | Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
![]() | Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
![]() | Protein automated matches [190369] (8 species) not a true protein |
![]() | Species Human immunodeficiency virus type 2 (isolate d194) [TaxId:11713] [189055] (2 PDB entries) |
![]() | Domain d2x82a_: 2x82 A: [169932] automated match to d1m9ec_ |
PDB Entry: 2x82 (more details), 2.6 Å
SCOPe Domain Sequences for d2x82a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x82a_ a.73.1.1 (A:) automated matches {Human immunodeficiency virus type 2 (isolate d194) [TaxId: 11713]} pvqhvggtythiplsprtlnawvklveekkfgaevvpgfqalsegctpydinqmlncvgd hqaamqiireiineeaaewdvqhpipagplpagqlreprgsdiagttstveeqiqwmfrp qnpvpvgniyrrwiqiglqkcvrmy
Timeline for d2x82a_: