Lineage for d1joyb_ (1joy B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709045Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 2709085Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) (S)
  5. 2709086Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (4 proteins)
  6. 2709087Protein EnvZ histidine kinase [47386] (1 species)
  7. 2709088Species Escherichia coli [TaxId:562] [47387] (1 PDB entry)
  8. 2709090Domain d1joyb_: 1joy B: [16992]

Details for d1joyb_

PDB Entry: 1joy (more details)

PDB Description: solution structure of the homodimeric domain of envz from escherichia coli by multi-dimensional nmr.
PDB Compounds: (B:) protein (envz_ecoli)

SCOPe Domain Sequences for d1joyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1joyb_ a.30.2.1 (B:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]}
maagvkqladdrtllmagvshdlrtpltrirlatemmseqdgylaesinkdieecnaiie
qfidylr

SCOPe Domain Coordinates for d1joyb_:

Click to download the PDB-style file with coordinates for d1joyb_.
(The format of our PDB-style files is described here.)

Timeline for d1joyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1joya_