![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
![]() | Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) ![]() |
![]() | Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (4 proteins) |
![]() | Protein EnvZ histidine kinase [47386] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [47387] (1 PDB entry) |
![]() | Domain d1joyb_: 1joy B: [16992] |
PDB Entry: 1joy (more details)
SCOPe Domain Sequences for d1joyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1joyb_ a.30.2.1 (B:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]} maagvkqladdrtllmagvshdlrtpltrirlatemmseqdgylaesinkdieecnaiie qfidylr
Timeline for d1joyb_: