SCOPe 2.08: Domain d1joyb_: 1joy B:

Lineage for d1joyb_ (1joy B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families)

5. Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (4 proteins)

6. Protein EnvZ histidine kinase [47386] (1 species)

7. Species Escherichia coli [TaxId:562] [47387] (1 PDB entry)

8. Domain d1joyb_: 1joy B: [16992]

Details for d1joyb_

PDB Entry: 1joy

PDB Description: solution structure of the homodimeric domain of envz from escherichia coli by multi-dimensional nmr.

PDB Compounds: (B:) protein (envz_ecoli)

SCOPe Domain Sequences for d1joyb_:

Sequence; same for both SEQRES and ATOM records:

>d1joyb_ a.30.2.1 (B:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]}
maagvkqladdrtllmagvshdlrtpltrirlatemmseqdgylaesinkdieecnaiie
qfidylr

Timeline for d1joyb_:

• d1joyb_ first appeared (with stable ids) in SCOP 1.55
  
• d1joyb_ appears in SCOPe 2.07