Lineage for d2x75a_ (2x75 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010373Protein automated matches [190147] (7 species)
    not a true protein
  7. 2010393Species Staphylococcus aureus [TaxId:1280] [189270] (1 PDB entry)
  8. 2010394Domain d2x75a_: 2x75 A: [169915]
    automated match to d1f1oa_
    complexed with amp, cl, oxl, p6g

Details for d2x75a_

PDB Entry: 2x75 (more details), 2.5 Å

PDB Description: Staphylococcus aureus adenylosuccinate lyase
PDB Compounds: (A:) adenylosuccinate lyase

SCOPe Domain Sequences for d2x75a_:

Sequence, based on SEQRES records: (download)

>d2x75a_ a.127.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ierysreemsniwtdqnryeawleveilaceawselghipkadvqkirqnakvnveraqe
ieqetrhdvvaftrqvsetlgeerkwvhygltstdvvdtalsfvikqandiiekdlerfi
dvlaekaknykytlmmgrthgvhaepttfgvkmalwytemqrnlqrfkqvreeievgkms
gavgtfanippeiesyvckhlgigtapvstqtlqrdrhayyiatlaliatslekfaveir
nlqktetreveeafakgqkgssamphkrnpigsenitgisrvirgyittayenvplwher
dishssaerimlpdvtialdyalnrftnivdrltvfednmrnnidktfglifsqrvllal
inkgmvreeaydkvqpkamiswetktpfrelieqdesitsvltkeeldecfdpkhhlnqv
dtiferagla

Sequence, based on observed residues (ATOM records): (download)

>d2x75a_ a.127.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ierysreemsniwtdqnryeawleveilaceawselghipkadvqkirqnakvnveraqe
ieqetrhdvvaftrqvsetlgeerkwvhygltstdvvdtalsfvikqandiiekdlerfi
dvlaekaknykytlmmgrthgvhaepttfgvkmalwytemqrnlqrfkqvreeievgkms
gavgtfanippeiesyvckhlgigtapvstqtlqrdrhayyiatlaliatslekfaveir
nlqktetreveeafakgqkgssamphkrnpigsenitgisrvirgyittayenvplwher
dishssaerimlpdvtialdyalnrftnivdrltvfednmrnnidktfglifsqrvllal
inkgmvreeaydkvqpkamiswetktpfrelieqdesittkeeldecfdpkhhlnqvdti
feragla

SCOPe Domain Coordinates for d2x75a_:

Click to download the PDB-style file with coordinates for d2x75a_.
(The format of our PDB-style files is described here.)

Timeline for d2x75a_: