SCOPe 2.08: Domain d2x6va_: 2x6v A:

Lineage for d2x6va_ (2x6v A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.4: T-box [81316] (3 proteins)
   automatically mapped to Pfam PF00907

6. Protein automated matches [191154] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189324] (4 PDB entries)

8. Domain d2x6va_: 2x6v A: [169909]
   automated match to d1h6fb_
   protein/DNA complex; complexed with mg, pe4

Details for d2x6va_

PDB Entry: 2x6v, 2.2 Å

PDB Description: crystal structure of human tbx5 in the dna-bound and dna-free form

PDB Compounds: (A:) t-box transcription factor tbx5

SCOPe Domain Sequences for d2x6va_:

Sequence, based on SEQRES records:

>d2x6va_ b.2.5.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gikvflherelwlkfhevgtemiitkagrrmfpsykvkvtglnpktkyillmdivpaddh
rykfadnkwsvtgkaepampgrlyvhpdspatgahwmrqlvsfqklkltnnhldpfghii
lnsmhkyqprlhivkadenngfgskntafcthvfpetafiavtsyqnhkitqlkiennpf
akgfrg

Sequence, based on observed residues (ATOM records):

>d2x6va_ b.2.5.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gikvflherelwlkfhevgtemiitkagrrmfpsykvkvtglnpktkyillmdivpaddh
rykfadnkwsvtgkaepampgrlyvhpdspatgahwmrqlvsfqklkltnnhldpfghii
lnsmhkyqprlhivkadtafcthvfpetafiavtsyqnhkitqlkiennpfakgfrg

Timeline for d2x6va_:

• d2x6va_ first appeared in SCOPe 2.01
  
• d2x6va_ appears in SCOPe 2.07