SCOPe 2.06: Domain d2x6ua_: 2x6u A:

Lineage for d2x6ua_ (2x6u A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.4: T-box [81316] (3 proteins)
   automatically mapped to Pfam PF00907

6. Protein automated matches [191154] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189324] (3 PDB entries)

8. Domain d2x6ua_: 2x6u A: [169908]
   automated match to d1h6fb_
   complexed with mg, pe4

Details for d2x6ua_

PDB Entry: 2x6u, 1.9 Å

PDB Description: crystal structure of human tbx5 in the dna-free form

PDB Compounds: (A:) t-box transcription factor tbx5

SCOPe Domain Sequences for d2x6ua_:

Sequence, based on SEQRES records:

>d2x6ua_ b.2.5.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egikvflherelwlkfhevgtemiitkagrrmfpsykvkvtglnpktkyillmdivpadd
hrykfadnkwsvtgkaepampgrlyvhpdspatgahwmrqlvsfqklkltnnhldpfghi
ilnsmhkyqprlhivkadenngfgskntafcthvfpetafiavtsyqnhkitqlkienn

Sequence, based on observed residues (ATOM records):

>d2x6ua_ b.2.5.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egikvflherelwlkfhevgtemiitkagrrmfpsykvkvtglnpktkyillmdivpadd
hrykfadnkwsvtgkaeparlyvhpdspatgahwmrqlvsfqklkltnnhldpfghiiln
smhkyqprlhivkadenngfgskntafcthvfpetafiavtsyqnhkitqlkienn

Timeline for d2x6ua_:

• d2x6ua_ first appeared in SCOPe 2.01
  
• d2x6ua_ appears in SCOPe 2.05
  
• d2x6ua_ appears in SCOPe 2.07
  
• d2x6ua_ appears in the current release, SCOPe 2.08