Lineage for d2x6ua_ (2x6u A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2768316Family b.2.5.4: T-box [81316] (3 proteins)
    automatically mapped to Pfam PF00907
  6. 2768325Protein automated matches [191154] (1 species)
    not a true protein
  7. 2768326Species Human (Homo sapiens) [TaxId:9606] [189324] (4 PDB entries)
  8. 2768327Domain d2x6ua_: 2x6u A: [169908]
    automated match to d1h6fb_
    complexed with mg, pe4

Details for d2x6ua_

PDB Entry: 2x6u (more details), 1.9 Å

PDB Description: crystal structure of human tbx5 in the dna-free form
PDB Compounds: (A:) t-box transcription factor tbx5

SCOPe Domain Sequences for d2x6ua_:

Sequence, based on SEQRES records: (download)

>d2x6ua_ b.2.5.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egikvflherelwlkfhevgtemiitkagrrmfpsykvkvtglnpktkyillmdivpadd
hrykfadnkwsvtgkaepampgrlyvhpdspatgahwmrqlvsfqklkltnnhldpfghi
ilnsmhkyqprlhivkadenngfgskntafcthvfpetafiavtsyqnhkitqlkienn

Sequence, based on observed residues (ATOM records): (download)

>d2x6ua_ b.2.5.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egikvflherelwlkfhevgtemiitkagrrmfpsykvkvtglnpktkyillmdivpadd
hrykfadnkwsvtgkaeparlyvhpdspatgahwmrqlvsfqklkltnnhldpfghiiln
smhkyqprlhivkadenngfgskntafcthvfpetafiavtsyqnhkitqlkienn

SCOPe Domain Coordinates for d2x6ua_:

Click to download the PDB-style file with coordinates for d2x6ua_.
(The format of our PDB-style files is described here.)

Timeline for d2x6ua_: