![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
![]() | Family b.2.5.4: T-box [81316] (3 proteins) automatically mapped to Pfam PF00907 |
![]() | Protein automated matches [191154] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189324] (4 PDB entries) |
![]() | Domain d2x6ua_: 2x6u A: [169908] automated match to d1h6fb_ complexed with mg, pe4 |
PDB Entry: 2x6u (more details), 1.9 Å
SCOPe Domain Sequences for d2x6ua_:
Sequence, based on SEQRES records: (download)
>d2x6ua_ b.2.5.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} egikvflherelwlkfhevgtemiitkagrrmfpsykvkvtglnpktkyillmdivpadd hrykfadnkwsvtgkaepampgrlyvhpdspatgahwmrqlvsfqklkltnnhldpfghi ilnsmhkyqprlhivkadenngfgskntafcthvfpetafiavtsyqnhkitqlkienn
>d2x6ua_ b.2.5.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} egikvflherelwlkfhevgtemiitkagrrmfpsykvkvtglnpktkyillmdivpadd hrykfadnkwsvtgkaeparlyvhpdspatgahwmrqlvsfqklkltnnhldpfghiiln smhkyqprlhivkadenngfgskntafcthvfpetafiavtsyqnhkitqlkienn
Timeline for d2x6ua_: