![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
![]() | Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) ![]() form dimers with different dimerisation modes |
![]() | Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
![]() | Protein Macrophage inflammatory protein, MIP [54128] (5 species) has different dimerisation mode |
![]() | Species Human (Homo sapiens), 1-alpha [TaxId:9606] [54130] (3 PDB entries) |
![]() | Domain d2x6gn_: 2x6g N: [169902] automated match to d1b50a_ |
PDB Entry: 2x6g (more details), 2.15 Å
SCOPe Domain Sequences for d2x6gn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x6gn_ d.9.1.1 (N:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-alpha [TaxId: 9606]} adtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqkyvs dlels
Timeline for d2x6gn_: