Lineage for d1rprb_ (1rpr B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709045Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 2709046Superfamily a.30.1: ROP protein [47380] (1 family) (S)
    automatically mapped to Pfam PF01815
  5. 2709047Family a.30.1.1: ROP protein [47381] (1 protein)
  6. 2709048Protein ROP protein [47382] (1 species)
  7. 2709049Species Escherichia coli [TaxId:562] [47383] (18 PDB entries)
    Uniprot P03051
  8. 2709071Domain d1rprb_: 1rpr B: [16990]

Details for d1rprb_

PDB Entry: 1rpr (more details)

PDB Description: the structure of cole1 rop in solution
PDB Compounds: (B:) rop

SCOPe Domain Sequences for d1rprb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rprb_ a.30.1.1 (B:) ROP protein {Escherichia coli [TaxId: 562]}
mtkqektalnmarfirsqtltlleklneldadeqadiceslhdhadelyrsclarfgddg
enl

SCOPe Domain Coordinates for d1rprb_:

Click to download the PDB-style file with coordinates for d1rprb_.
(The format of our PDB-style files is described here.)

Timeline for d1rprb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rpra_