| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) ![]() form dimers with different dimerisation modes |
| Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
| Protein Macrophage inflammatory protein, MIP [54128] (5 species) has different dimerisation mode |
| Species Human (Homo sapiens), 1-alpha [TaxId:9606] [54130] (3 PDB entries) |
| Domain d2x6gh_: 2x6g H: [169896] automated match to d1b50a_ |
PDB Entry: 2x6g (more details), 2.15 Å
SCOPe Domain Sequences for d2x6gh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x6gh_ d.9.1.1 (H:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-alpha [TaxId: 9606]}
aadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqkyv
sdlel
Timeline for d2x6gh_: