Lineage for d2x6gg_ (2x6g G:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016266Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1016267Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1016268Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1016336Protein Macrophage inflammatory protein, MIP [54128] (5 species)
    has different dimerisation mode
  7. 1016337Species Human (Homo sapiens), 1-alpha [TaxId:9606] [54130] (3 PDB entries)
  8. 1016344Domain d2x6gg_: 2x6g G: [169895]
    automated match to d1b50a_

Details for d2x6gg_

PDB Entry: 2x6g (more details), 2.15 Å

PDB Description: x-ray structure of macrophage inflammatory protein-1 alpha (d27a)
PDB Compounds: (G:) C-C motif chemokine 3

SCOPe Domain Sequences for d2x6gg_:

Sequence, based on SEQRES records: (download)

>d2x6gg_ d.9.1.1 (G:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-alpha [TaxId: 9606]}
adtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqkyvs
dlel

Sequence, based on observed residues (ATOM records): (download)

>d2x6gg_ d.9.1.1 (G:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-alpha [TaxId: 9606]}
adtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcdpseewvqkyvsd
lel

SCOPe Domain Coordinates for d2x6gg_:

Click to download the PDB-style file with coordinates for d2x6gg_.
(The format of our PDB-style files is described here.)

Timeline for d2x6gg_: