Lineage for d2x61a_ (2x61 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151564Fold c.130: Alpha-2,3/8-sialyltransferase CstII [102413] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 8 strands, order 54321678
  4. 2151565Superfamily c.130.1: Alpha-2,3/8-sialyltransferase CstII [102414] (2 families) (S)
  5. 2151566Family c.130.1.1: Alpha-2,3/8-sialyltransferase CstII [102415] (2 protein domains)
    automatically mapped to Pfam PF06002
  6. 2151567Protein Alpha-2,3/8-sialyltransferase CstII [102416] (1 species)
  7. 2151568Species Campylobacter jejuni [TaxId:197] [102417] (5 PDB entries)
  8. 2151569Domain d2x61a_: 2x61 A: [169883]
    automated match to d1ro8a_
    complexed with act, ch, edo, mpd

Details for d2x61a_

PDB Entry: 2x61 (more details), 1.95 Å

PDB Description: crystal structure of the sialyltransferase cst-ii in complex with trisaccharide acceptor and cmp
PDB Compounds: (A:) alpha-2,3-/2,8-sialyltransferase

SCOPe Domain Sequences for d2x61a_:

Sequence, based on SEQRES records: (download)

>d2x61a_ c.130.1.1 (A:) Alpha-2,3/8-sialyltransferase CstII {Campylobacter jejuni [TaxId: 197]}
kkviiagngpslkeidysrlpndfdvfrcnqfyfedkyylgkkckavfynpslffeqyyt
lkhliqnqeyetelimcsnynqahlenenfvktfydyfpdahlgydffkqlkdfnayfkf
heiyfnqritsgvymcavaialgykeiylsgidfyqngssyafdtkqknllklapnfknd
nshyighskntdikaleflektykiklyclcpnsllanfiglapnlnsnfiiqeknnytk
dilipsseaygkfskni

Sequence, based on observed residues (ATOM records): (download)

>d2x61a_ c.130.1.1 (A:) Alpha-2,3/8-sialyltransferase CstII {Campylobacter jejuni [TaxId: 197]}
kkviiagngpslkeidysrlpndfdvfrcnqfyfedkyylgkkckavfynpslffeqyyt
lkhliqnqeyetelimcsnynqahlenenfvktfydyfpdahlgydffkqlkdfnayfkf
heiyfnqritsgvymcavaialgykeiylsgidfyqssyafdtkqknllklapnfskntd
ikaleflektykiklyclcpnsllanfiglapnlnsnfiiqeknnytkdilipsseaygk
fskni

SCOPe Domain Coordinates for d2x61a_:

Click to download the PDB-style file with coordinates for d2x61a_.
(The format of our PDB-style files is described here.)

Timeline for d2x61a_: