Lineage for d2x4db_ (2x4d B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2149297Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2149298Protein automated matches [190447] (51 species)
    not a true protein
  7. 2149520Species Human (Homo sapiens) [TaxId:9606] [188990] (13 PDB entries)
  8. 2149527Domain d2x4db_: 2x4d B: [169852]
    automated match to d1pw5a_
    complexed with epe, gol, mg, pop

Details for d2x4db_

PDB Entry: 2x4d (more details), 1.92 Å

PDB Description: crystal structure of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase lhpp
PDB Compounds: (B:) phospholysine phosphohistidine inorganic pyrophosphate phosphatase

SCOPe Domain Sequences for d2x4db_:

Sequence, based on SEQRES records: (download)

>d2x4db_ c.108.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lldisgvlydsgagggtaiagsveavarlkrsrlkvrfctnesaasraelvgqlqrlgfd
iseqevtapapaacqilkerglrpyllihdgvrsefdqidtsnpncvviadagesfsyqn
mnnafqvlmelekpvlislgkgryyaatsglmldvgpymkaleyacgikaevvgkpspef
fksalqaigveahqavmigddivgdvggaqrcgmralqvrtgkfrpsdehhpevkadgyv
dnlaea

Sequence, based on observed residues (ATOM records): (download)

>d2x4db_ c.108.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lldisgvlydsggtaiagsveavfctnesaasraelvgqltapapaacqilkerglrpyl
lihdgvrsefdnpncvviadagesfsyqnmnnafqvlmelekpvlislgkgryyaaglml
dvgpymkaleyacgikaevvgkpspeffksalqaigveahqavmigddivgdvggaqrcg
mralqvrtgkfrpsdehhpevkadgyvdnlaea

SCOPe Domain Coordinates for d2x4db_:

Click to download the PDB-style file with coordinates for d2x4db_.
(The format of our PDB-style files is described here.)

Timeline for d2x4db_: