Lineage for d2x4da_ (2x4d A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920500Species Human (Homo sapiens) [TaxId:9606] [188990] (19 PDB entries)
  8. 2920505Domain d2x4da_: 2x4d A: [169851]
    automated match to d1pw5a_
    complexed with epe, gol, mg, pop

Details for d2x4da_

PDB Entry: 2x4d (more details), 1.92 Å

PDB Description: crystal structure of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase lhpp
PDB Compounds: (A:) phospholysine phosphohistidine inorganic pyrophosphate phosphatase

SCOPe Domain Sequences for d2x4da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x4da_ c.108.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smapwgkrlagvrgvlldisgvlydsgagggtaiagsveavarlkrsrlkvrfctnesaa
sraelvgqlqrlgfdiseqevtapapaacqilkerglrpyllihdgvrsefdqidtsnpn
cvviadagesfsyqnmnnafqvlmelekpvlislgkgryyaatsglmldvgpymkaleya
cgikaevvgkpspeffksalqaigveahqavmigddivgdvggaqrcgmralqvrtgkfr
psdehhpevkadgyvdnlaeavdlllqhad

SCOPe Domain Coordinates for d2x4da_:

Click to download the PDB-style file with coordinates for d2x4da_.
(The format of our PDB-style files is described here.)

Timeline for d2x4da_: