Lineage for d1f4mc_ (1f4m C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995434Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 1995435Superfamily a.30.1: ROP protein [47380] (1 family) (S)
    automatically mapped to Pfam PF01815
  5. 1995436Family a.30.1.1: ROP protein [47381] (1 protein)
  6. 1995437Protein ROP protein [47382] (1 species)
  7. 1995438Species Escherichia coli [TaxId:562] [47383] (17 PDB entries)
    Uniprot P03051
  8. 1995470Domain d1f4mc_: 1f4m C: [16985]
    a multiple mutant with a repacked hydrophobic core and a new dimerization mode
    complexed with ca

Details for d1f4mc_

PDB Entry: 1f4m (more details), 2.25 Å

PDB Description: p3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold.
PDB Compounds: (C:) rop ala2ile2-6

SCOPe Domain Sequences for d1f4mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4mc_ a.30.1.1 (C:) ROP protein {Escherichia coli [TaxId: 562]}
tkqektilnmarfirsqaltilekaneldadeiadiaesihdhadeiyrsalar

SCOPe Domain Coordinates for d1f4mc_:

Click to download the PDB-style file with coordinates for d1f4mc_.
(The format of our PDB-style files is described here.)

Timeline for d1f4mc_: