Lineage for d2x3wd_ (2x3w D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783623Species Mouse (Mus musculus) [TaxId:10090] [189303] (27 PDB entries)
  8. 2783632Domain d2x3wd_: 2x3w D: [169849]
    automated match to d1arka_

Details for d2x3wd_

PDB Entry: 2x3w (more details), 2.64 Å

PDB Description: structure of mouse syndapin I (crystal form 2)
PDB Compounds: (D:) protein kinase c and casein kinase substrate in neurons protein 1

SCOPe Domain Sequences for d2x3wd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x3wd_ b.34.2.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vrvralydydgqeqdelsfkagdeltklgeedeqgwcrgrldsgqlglypanyvea

SCOPe Domain Coordinates for d2x3wd_:

Click to download the PDB-style file with coordinates for d2x3wd_.
(The format of our PDB-style files is described here.)

Timeline for d2x3wd_: