| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.61: MTH889-like [160363] (2 families) ![]() assembles into hexameric ring-like structures with the formation of a singe beta-barrel sheet of 24 strands |
| Family d.58.61.0: automated matches [191641] (1 protein) not a true family |
| Protein automated matches [191179] (1 species) not a true protein |
| Species Sulfolobus solfataricus [TaxId:273057] [189435] (1 PDB entry) |
| Domain d2x3dg1: 2x3d G:1-89 [169845] Other proteins in same PDB: d2x3da2, d2x3db2, d2x3dc2, d2x3dd2, d2x3de2, d2x3dg2, d2x3dh2 automated match to d2raqa1 |
PDB Entry: 2x3d (more details), 2.7 Å
SCOPe Domain Sequences for d2x3dg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x3dg1 d.58.61.0 (G:1-89) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mairrlvldvlkpirgtsivdlaeriskldgvegvnisvtdmdvetmglmiiiegtslnf
ddirkmleeegcaihsidevvsgnriieg
Timeline for d2x3dg1: