Lineage for d2x3de1 (2x3d E:1-89)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2199031Superfamily d.58.61: MTH889-like [160363] (2 families) (S)
    assembles into hexameric ring-like structures with the formation of a singe beta-barrel sheet of 24 strands
  5. 2199058Family d.58.61.0: automated matches [191641] (1 protein)
    not a true family
  6. 2199059Protein automated matches [191179] (1 species)
    not a true protein
  7. 2199060Species Sulfolobus solfataricus [TaxId:273057] [189435] (1 PDB entry)
  8. 2199065Domain d2x3de1: 2x3d E:1-89 [169843]
    Other proteins in same PDB: d2x3da2, d2x3db2, d2x3dc2, d2x3dd2, d2x3de2, d2x3dg2, d2x3dh2
    automated match to d2raqa1

Details for d2x3de1

PDB Entry: 2x3d (more details), 2.7 Å

PDB Description: crystal structure of sso6206 from sulfolobus solfataricus p2
PDB Compounds: (E:) sso6206

SCOPe Domain Sequences for d2x3de1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x3de1 d.58.61.0 (E:1-89) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mairrlvldvlkpirgtsivdlaeriskldgvegvnisvtdmdvetmglmiiiegtslnf
ddirkmleeegcaihsidevvsgnriieg

SCOPe Domain Coordinates for d2x3de1:

Click to download the PDB-style file with coordinates for d2x3de1.
(The format of our PDB-style files is described here.)

Timeline for d2x3de1: