SCOPe 2.08: Domain d2x3dc1: 2x3d C:1-89

Lineage for d2x3dc1 (2x3d C:1-89)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.61: MTH889-like [160363] (2 families)
   assembles into hexameric ring-like structures with the formation of a singe beta-barrel sheet of 24 strands

5. Family d.58.61.0: automated matches [191641] (1 protein)
   not a true family

6. Protein automated matches [191179] (1 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [189435] (1 PDB entry)

8. Domain d2x3dc1: 2x3d C:1-89 [169841]
   Other proteins in same PDB: d2x3da2, d2x3db2, d2x3dc2, d2x3dd2, d2x3de2, d2x3dg2, d2x3dh2
   automated match to d2raqa1

Details for d2x3dc1

PDB Entry: 2x3d, 2.7 Å

PDB Description: crystal structure of sso6206 from sulfolobus solfataricus p2

PDB Compounds: (C:) sso6206

SCOPe Domain Sequences for d2x3dc1:

Sequence; same for both SEQRES and ATOM records:

>d2x3dc1 d.58.61.0 (C:1-89) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mairrlvldvlkpirgtsivdlaeriskldgvegvnisvtdmdvetmglmiiiegtslnf
ddirkmleeegcaihsidevvsgnriieg

Timeline for d2x3dc1:

• d2x3dc1 first appeared in SCOPe 2.01, called d2x3dc_
  
• d2x3dc1 appears in SCOPe 2.07