SCOPe 2.05: Domain d1f4mb_: 1f4m B:

Lineage for d1f4mb_ (1f4m B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.1: ROP protein [47380] (1 family)
   automatically mapped to Pfam PF01815

5. Family a.30.1.1: ROP protein [47381] (1 protein)

6. Protein ROP protein [47382] (1 species)

7. Species Escherichia coli [TaxId:562] [47383] (17 PDB entries)
   Uniprot P03051

8. Domain d1f4mb_: 1f4m B: [16984]
   a multiple mutant with a repacked hydrophobic core and a new dimerization mode
   complexed with ca

Details for d1f4mb_

PDB Entry: 1f4m, 2.25 Å

PDB Description: p3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold.

PDB Compounds: (B:) rop ala2ile2-6

SCOPe Domain Sequences for d1f4mb_:

Sequence; same for both SEQRES and ATOM records:

>d1f4mb_ a.30.1.1 (B:) ROP protein {Escherichia coli [TaxId: 562]}
tkqektilnmarfirsqaltilekaneldadeiadiaesihdhadeiyrsalarfg

Timeline for d1f4mb_:

• d1f4mb_ first appeared (with stable ids) in SCOP 1.55
  
• d1f4mb_ appears in SCOPe 2.04
  
• d1f4mb_ appears in SCOPe 2.06
  
• d1f4mb_ appears in the current release, SCOPe 2.08