![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
![]() | Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) ![]() the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
![]() | Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins) |
![]() | Protein automated matches [190527] (4 species) not a true protein |
![]() | Species Escherichia coli [TaxId:469008] [189333] (2 PDB entries) |
![]() | Domain d2x2wa_: 2x2w A: [169834] automated match to d1gs5a_ complexed with so4, x2w |
PDB Entry: 2x2w (more details), 2 Å
SCOPe Domain Sequences for d2x2wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x2wa_ c.73.1.2 (A:) automated matches {Escherichia coli [TaxId: 469008]} mmnpliiklggvlldseealerlfsalvnyreshqrplvivhgggcvvdelmkglnlpvk kknglrvtpadqidiitgalagtanktllawakkhqiaavglflgdgdsvkvtqldeelg hvglaqpgspklinsllengylpvvssigvtdegqlmnvnadqaatalaatlgadlills dvsgildgkgqriaemtaakaeqlieqgiitdgmivkvnaaldaartlgrpvdiaswrha eqlpalfngmpmgtrila
Timeline for d2x2wa_: