SCOPe 2.05: Domain d2x2dd_: 2x2d D:

Lineage for d2x2dd_ (2x2d D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein automated matches [190369] (6 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (7 PDB entries)

8. Domain d2x2dd_: 2x2d D: [169823]
   Other proteins in same PDB: d2x2db_, d2x2dc_
   automated match to d1afva_

Details for d2x2dd_

PDB Entry: 2x2d, 1.9 Å

PDB Description: acetyl-cypa:hiv-1 n-term capsid domain complex

PDB Compounds: (D:) capsid protein p24

SCOPe Domain Sequences for d2x2dd_:

Sequence; same for both SEQRES and ATOM records:

>d2x2dd_ a.73.1.1 (D:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

Timeline for d2x2dd_:

• d2x2dd_ first appeared in SCOPe 2.01
  
• d2x2dd_ appears in SCOPe 2.04
  
• d2x2dd_ appears in SCOPe 2.06
  
• d2x2dd_ appears in the current release, SCOPe 2.08